- Metaxin-2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87435
- Human
- 0.1 ml (also 25ul)
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: DGLEEVQKAE MKAYMELVNN MLLTAELYLQ WCDEATVGEI THARYGSPYP WPLNHILAYQ KQWEVKRKMK AIG
- Metaxin-2
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- metaxin 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- MDPS, metaxin-2
- Endocrinology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
DGLEEVQKAEMKAYMELVNNMLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIG
Specifications/Features
Available conjugates: Unconjugated